PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009629774.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 298aa    MW: 34247.9 Da    PI: 7.054
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009629774.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.52.2e-5281321128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelv++yL++k++++++ +  +i+e+d+yk++PwdLp+ +  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ + 
  XP_009629774.1   8 LPPGFRFHPTDEELVMHYLCRKCASQPIAV-PIIAEIDLYKYDPWDLPHLALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGH- 100
                     79**************************99.88***************7656689*************************************99. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + +g+kk Lvfy g+apkgekt+W+mheyrl
  XP_009629774.1 101 -PKPMGIKKALVFYAGKAPKGEKTNWIMHEYRL 132
                     .789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-634159IPR003441NAC domain
PROSITE profilePS5100560.2698159IPR003441NAC domain
PfamPF023651.7E-279132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MTAAELQLPP GFRFHPTDEE LVMHYLCRKC ASQPIAVPII AEIDLYKYDP WDLPHLALYG  60
EKEWYFFSPR DRKYPNGSRP NRAAGTGYWK ATGADKPIGH PKPMGIKKAL VFYAGKAPKG  120
EKTNWIMHEY RLADVDRSAR KNNNSLRLDD WVLCRIYNKK GSIEKNQLSN RKMNTSYMDM  180
VESPEDRKPE ILPPLPPPPQ QVHSDFFYLD PSDSVPKIHS DSSCSEHVLS PEFTCEREVQ  240
SEPKLTNWEK STLDLPFNYM DATTGATTVD NSLLGSQFQS SYQMSPLQDM FMHLHKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-83416511174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6108010.0AB610801.1 Nicotiana benthamiana mRNA for Nam-like protein, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629774.10.0PREDICTED: NAC domain-containing protein 2
RefseqXP_016481807.10.0PREDICTED: NAC domain-containing protein 2-like
SwissprotQ390131e-145NAC2_ARATH; NAC domain-containing protein 2
TrEMBLQ8LRL50.0Q8LRL5_PETHY; Nam-like protein 10
STRINGSolyc06g060230.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-144NAC family protein